Tesamorelin 20mg

Tesamorelin 20mg

£124.99

In Stock

Expiry Date:March 11, 2029

Medicine Type: Injection

Manufacturer: Nexera

In Stock

100% Genuine

Fast Delivery

Easy Returns

Batch COA Published

Guaranteed Safe Checkout:

Description

What is tesamorelin?

Tesamorelin is a synthetic 44-amino-acid peptide analogue of human growth hormone-releasing hormone (GHRH). In the laboratory it is used in in-vitro receptor-signalling assays and peptide stability studies.

How does tesamorelin differ from native GHRH?

It has the same 44 amino acids as human GHRH(1-44), with a C-terminal amide, plus a trans-3-hexenoyl group on the N-terminal tyrosine. This modification is reported to make it more resistant to cleavage by dipeptidyl peptidase-4 (DPP-4).

What are the specifications of Tesamorelin 20mg?

Tesamorelin 20mg is a 44-residue peptide (free base: CAS 218949-48-5, C221H366N72O67S, 5135.9 g/mol), supplied as 20mg per unit.

Name	Tesamorelin (INN)
Description	Synthetic analogue of human GHRH(1-44)
Length	44 amino acids
Sequence	YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
N-terminal modification	trans-3-hexenoyl group on Tyr1
C-terminus	Amide (Leu-NH2)
CAS number (free base)	218949-48-5
Molecular formula (free base)	C221H366N72O67S
Molecular weight (free base)	5135.9 g/mol
Salt form and counter-ion	Stated on the batch COA
Amount per unit	20mg
Purity	≥98% by HPLC (exact value on the batch COA)
Identity	Mass spectrometry (result on the batch COA)
Supplied for	Laboratory research only

Does Tesamorelin 20mg come with a certificate of analysis?

Yes. Each batch is supplied with a certificate of analysis showing HPLC purity, mass spectrometry data, the batch number and the test date. Check the batch number on your label against the report.

How should Tesamorelin 20mg be stored?

Store as supplied, sealed and protected from light, at the temperature stated on the batch COA. Stock is held at −20°C and shipped in insulated packaging. Wear laboratory personal protective equipment when handling.

How is Tesamorelin 20mg shipped?

Orders paid before 2pm, Monday to Friday, ship the same working day by Royal Mail Tracked 24, in plain outer packaging with no product information. UK delivery only.

Storage and Handling

Store and handle according to the applicable batch Certificate of Analysis and Safety Data Sheet. Protect the material from unsuitable environmental conditions. Appropriate laboratory personal protective equipment should be worn.

Documentation

Each batch should be accompanied by appropriate analytical documentation identifying the supplied material, batch number and applicable analytical testing information.

Dispatch

Orders placed and paid before 2pm, Monday to Friday, are dispatched the same working day via Royal Mail Tracked 24. Research materials ship in suitable protective packaging. Outer packaging is plain and carries no product information.

Reviews (0)

(0 Ratings)

Be the first to review “Tesamorelin 20mg”

There are no reviews yet.

Compliance & Notes

Compliance Block

This product is supplied strictly for in vitro laboratory research and analytical use. It is not a medicinal product and is not intended for human or veterinary consumption, administration, diagnosis or treatment. We do not provide dosing information, reconstitution protocols for administration, or guidance concerning human or veterinary use. By purchasing you confirm that you are aged 21 or over and are acquiring this material for laboratory research purposes only.